Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FNDC11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C20orf195 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FNDC11 Polyclonal specifically detects FNDC11 in Human samples. It is validated for Western Blot.Specifications
C20orf195 | |
Polyclonal | |
Rabbit | |
Q9BVV2 | |
79025 | |
Synthetic peptides corresponding to C20ORF195 The peptide sequence was selected from the N terminal of C20ORF195. Peptide sequence RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 20 open reading frame 195, hypothetical protein LOC79025, MGC5356 | |
C20ORF195 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title