Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FNDC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | FNDC4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159690
|
Novus Biologicals
NBP159690 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15969020
|
Novus Biologicals
NBP15969020UL |
20 μL | N/A | N/A | N/A | ||||
Description
FNDC4 Polyclonal specifically detects FNDC4 in Human, Rabbit samples. It is validated for Western Blot.Specifications
| FNDC4 | |
| Polyclonal | |
| Rabbit | |
| Q9H6D8 | |
| 64838 | |
| Synthetic peptides corresponding to FNDC4(fibronectin type III domain containing 4) The peptide sequence was selected from the middle region of FNDC4. Peptide sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| fibronectin type III domain containing 4, fibronectin type III domain-containing protein 4, Fibronectin type III repeat-containing protein 1, FRCP1FLJ22362 | |
| FNDC4 | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title