Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FNDC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Specifications
| Antigen | FNDC4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15969020
|
Novus Biologicals
NBP15969020UL |
20 μL |
Each for $152.22
|
N/A |
NBP159690
|
Novus Biologicals
NBP159690 |
100 μL |
Each for $436.00
|
N/A |
Description
FNDC4 Polyclonal specifically detects FNDC4 in Human, Rabbit samples. It is validated for Western Blot.Specifications
| FNDC4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| fibronectin type III domain containing 4, fibronectin type III domain-containing protein 4, Fibronectin type III repeat-containing protein 1, FRCP1FLJ22362 | |
| FNDC4 | |
| IgG | |
| Affinity Purified | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9H6D8 | |
| 64838 | |
| Synthetic peptides corresponding to FNDC4(fibronectin type III domain containing 4) The peptide sequence was selected from the middle region of FNDC4. Peptide sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title