Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FNDC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Specifications

Antigen FNDC4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15969020
View Documents
Novus Biologicals
NBP15969020UL
20 μL
Each for $152.22
N/A
NBP159690
View Documents
Novus Biologicals
NBP159690
100 μL
Each for $436.00
N/A
Description

Description

FNDC4 Polyclonal specifically detects FNDC4 in Human, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

FNDC4
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
fibronectin type III domain containing 4, fibronectin type III domain-containing protein 4, Fibronectin type III repeat-containing protein 1, FRCP1FLJ22362
FNDC4
IgG
Affinity Purified
25 kDa
Western Blot
Unconjugated
RUO
Q9H6D8
64838
Synthetic peptides corresponding to FNDC4(fibronectin type III domain containing 4) The peptide sequence was selected from the middle region of FNDC4. Peptide sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit