FNTA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183428

Catalog No. NBP183428

Description

FNTA Polyclonal specifically detects FNTA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FNTA
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: CAAX farnesyltransferase subunit alpha, EC 2.5.1.58, EC 2.5.1.59, farnesyl-protein transferase alpha-subunit, farnesyltransferase, CAAX box, alpha, FPTA, FTase-alpha, GGTase-I-alpha, MGC99680, PGGT1A, protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, protein prenyltransferase alpha subunit repeat containing 2, PTAR2, Ras proteins prenyltransferase subunit alpha, type I protein geranyl-geranyltransferase alpha subunit, Type I protein geranyl-geranyltransferase subunit alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FNTA
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 2339
• Target Species: Human
• Isotype: IgG

For Research Use Only