FOXA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255686

Catalog No. NBP255686

Description

FOXA3 Polyclonal specifically detects FOXA3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FOXA3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FKHH3, Fork head-related protein FKH H3, forkhead box A3, Forkhead box protein A3, hepatocyte nuclear factor 3, gamma, hepatocyte nuclear factor 3-gamma, HNF-3G, HNF-3-gamma, HNF3GTCF-3G, MGC10179, TCF3G, Transcription factor 3G
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FOXA3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGP
• Quantity: 100 μL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 3171
• Target Species: Human
• Isotype: IgG

For Research Use Only