FoxC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18902525UL

Catalog No. NB430963

Description

FoxC1 Polyclonal specifically detects FoxC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FoxC1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ARA, FKHL7RIEG3, forkhead box C1, forkhead box protein C1, forkhead, drosophila, homolog-like 7, forkhead/winged helix-like transcription factor 7, forkhead-related activator 3, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC-3, FREAC3IRID1, IGDA, IHG1, myeloid factor-delta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FOXC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 2296
• Target Species: Human
• Isotype: IgG

For Research Use Only