Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOXE3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FOXE3 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
FOXE3 Polyclonal specifically detects FOXE3 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
FOXE3 | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Neuroscience, Sensory Systems, Vision | |
PBS buffer, 2% sucrose | |
2301 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
Human | |
ASMD, FKHL12forkhead, drosophila, homolog-like 12, forkhead box E3, Forkhead-related protein FKHL12, Forkhead-related transcription factor 8, FREAC-8, FREAC8forkhead box protein E3 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXE3 (NP_036318). Peptide sequence PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAE | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title