FOXI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24966025UL

Catalog No. NB395567

Description

FOXI1 Polyclonal antibody specifically detects FOXI1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: FOXI1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: FKHL10HFH3, forkhead box I1, forkhead box protein I1, forkhead-like 10, forkhead-related activator 6, Forkhead-related protein FKHL10, Forkhead-related transcription factor 6, FREAC-6, FREAC6FKH10, Hepatocyte nuclear factor 3 forkhead homolog 3, HFH-3, HNF-3/fork-head homolog 3, HNF-3/fork-head homolog-3, MGC34197
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2299
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG