FRA-1/FOSL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257326

Catalog No. NBP257326

Description

FRA-1/FOSL1 Polyclonal specifically detects FRA-1/FOSL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FRA-1/FOSL1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FOS-like antigen 1, FOS-like antigen-1, fos-related antigen 1, FRA, fra-1, FRA1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FOSL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Wnt Signaling Pathway
• Gene ID (Entrez): 8061
• Target Species: Human
• Isotype: IgG

For Research Use Only