Invitrogen™ Fra1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595521

Catalog No. PIPA595521

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A375 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The v-Fos oncogene was initially detected in two independent murine osteosarcoma virus isolates and an avian nephroblastoma virus. Members of the c-Fos gene family, including c-Fos, Fos B, Fra-1 and Fra-2, encode nuclear phosphoproteins that are rapidly and transiently induced by a variety of agents and function as transcriptional regulators for several genes. In contrast to c-Jun proteins, which form homo- and heterodimers that bind to specific DNA response elements, c-Fos proteins are only active as heterodimers with members of the Jun gene family. In addition, selected ATF/CREB family members can form leucine zipper dimers with Fos and Jun. Different dimers exhibit differential specificity and affinity for AP-1 and CRE sites.

Specifications

• Antigen: Fra1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FOSL1
• Gene Alias: AW538199; FOS like 1, AP-1 trancription factor subunit; FOS like 1, AP-1 transcription factor subunit; FOS like antigen 1; Fosl1; FOS-like antigen 1; FOS-like antigen-1; fos-related antigen 1; FRA; Fra1; fra-1; HGNC:13718; LOW QUALITY PROTEIN: fos-related antigen 1
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 8061
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P15407
• Gene Symbols: FOSL1
• Immunogen: A synthetic peptide corresponding to a sequence of human FRA1 (QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov