Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FRG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31771525UL
This item is not returnable.
View return policy
Description
FRG1 Polyclonal antibody specifically detects FRG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
FRG1 | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
facioscapulohumeral muscular dystrophy region gene-1, FSG1FRG1A, FSHD region gene 1, FSHD region gene 1 protein, protein FRG1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: REEHEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIH | |
25 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
2483 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction