Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Frizzled-7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Frizzled-7 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Frizzled-7 Polyclonal specifically detects Frizzled-7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Frizzled-7 | |
Polyclonal | |
Rabbit | |
GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
8324 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
frizzled (Drosophila) homolog 7, frizzled homolog 7 (Drosophila), Frizzled, drosophila, homolog of, 7, Fz-7, FzE3frizzled-7, hFz7 | |
FZD7 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title