Fructosamine-3-kinase-related Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324856

Catalog No. NB301596

Description

Fructosamine-3-kinase-related Polyclonal antibody specifically detects Fructosamine-3-kinase-related in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Fructosamine-3-kinase-related
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: EC 2.7.1.-, EC 2.7.1.172, FLJ12171, FN3KL, FN3K-related protein, FN3KRP, FN3K-RP, fructosamine 3 kinase related protein, Fructosamine-3-kinase-related protein, ketosamine-3-kinase, Protein-psicosamine 3-kinase FN3KRP
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Fructosamine-3-kinase-related using the following amino acid sequence: GRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIKVLDA
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 79672
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified