Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fructosamine-3-kinase-related Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Fructosamine-3-kinase-related |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Fructosamine-3-kinase-related Polyclonal specifically detects Fructosamine-3-kinase-related in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Fructosamine-3-kinase-related | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
EC 2.7.1.-, FLJ12171, FN3KL, FN3K-related protein, FN3K-RP, fructosamine 3 kinase related protein, Fructosamine-3-kinase-related protein, ketosamine-3-kinase | |
FN3KRP | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
79672 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title