FSCN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179542

Catalog No. NBP179542

Description

FSCN3 Polyclonal specifically detects FSCN3 in Human samples. It is validated for Western Blot, PCR.

Specifications

• Antigen: FSCN3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein, fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotuspurpuratus), fascin-3, testicular), Testis fascin
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%; Rat: 86%; Mouse: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, PCR
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, PCR
• Gene Accession No.: NP_065102
• Gene Symbols: FSCN3
• Immunogen: Synthetic peptide directed towards the middle region of human FSCN3The immunogen for this antibody is FSCN3. Peptide sequence WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29999
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.