Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSCN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FSCN3 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
FSCN3 Polyclonal specifically detects FSCN3 in Human samples. It is validated for Western Blot, PCR.Specifications
FSCN3 | |
Unconjugated | |
RUO | |
fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein, fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotuspurpuratus), fascin-3, testicular), Testis fascin | |
FSCN3 | |
IgG | |
55 kDa |
Polyclonal | |
Rabbit | |
NP_065102 | |
29999 | |
Synthetic peptide directed towards the middle region of human FSCN3The immunogen for this antibody is FSCN3. Peptide sequence WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title