Learn More
Description
Specifications
Specifications
| Antigen | FSD1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | fibronectin type 3 and SPRY domain containing 1, fibronectin type III and SPRY domain containing 1, fibronectin type III and SPRY domain-containing protein 1, GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1, MGC3213, Microtubule-associated protein GLFND, midline 1-related protein 1, MIR1MID1-related protein 1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FSD1 (NP_077309.1). Peptide sequence SPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEVRYEPDS |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
