FSD1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179841

Catalog No. NBP179841

Description

FSD1L Polyclonal specifically detects FSD1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FSD1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CCDC10MGC45564, Coiled-coil domain-containing protein 10, CSDUFD1, cystatin and DUF19 domain containing 1, fibronectin type III and SPRY domain containing 1-like, FSD1 C-terminal like, FSD1 N-terminal like, FSD1 N-terminal-like protein, FSD1CL, FSD1-like protein, FSD1NLcoiled-coil domain containing 10, MIR1
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_997530
• Gene Symbols: FSD1L
• Immunogen: Synthetic peptide directed towards the C terminal of human FSD1LThe immunogen for this antibody is FSD1L. Peptide sequence KGQESKIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83856
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG