Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FSD1L Antibody, Novus Biologicals™

FSD1L Antibody, Novus Biologicals™
SDP

Catalog No. p-7109616 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179841 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179841 Supplier Novus Biologicals Supplier No. NBP179841
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FSD1L Polyclonal specifically detects FSD1L in Human samples. It is validated for Western Blot.

Specifications

Antigen FSD1L
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_997530
Gene Alias CCDC10MGC45564, Coiled-coil domain-containing protein 10, CSDUFD1, cystatin and DUF19 domain containing 1, fibronectin type III and SPRY domain containing 1-like, FSD1 C-terminal like, FSD1 N-terminal like, FSD1 N-terminal-like protein, FSD1CL, FSD1-like protein, FSD1NLcoiled-coil domain containing 10, MIR1
Gene Symbols FSD1L
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human FSD1LThe immunogen for this antibody is FSD1L. Peptide sequence KGQESKIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGD.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83856
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.