Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FSD1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	FSD1L
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179841 View Documents View Product Certificates	Novus Biologicals NBP179841	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FSD1L Polyclonal specifically detects FSD1L in Human samples. It is validated for Western Blot.

Specifications

Antigen	FSD1L
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_997530
Gene ID (Entrez)	83856
Immunogen	Synthetic peptide directed towards the C terminal of human FSD1LThe immunogen for this antibody is FSD1L. Peptide sequence KGQESKIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGD.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	CCDC10MGC45564, Coiled-coil domain-containing protein 10, CSDUFD1, cystatin and DUF19 domain containing 1, fibronectin type III and SPRY domain containing 1-like, FSD1 C-terminal like, FSD1 N-terminal like, FSD1 N-terminal-like protein, FSD1CL, FSD1-like protein, FSD1NLcoiled-coil domain containing 10, MIR1
Gene Symbols	FSD1L
Isotype	IgG
Molecular Weight of Antigen	56 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FSD1L Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents