Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSTL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15285320UL
Description
FSTL5 Polyclonal specifically detects FSTL5 in Human samples. It is validated for Western Blot.Specifications
FSTL5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
follistatin-like 5, Follistatin-like protein 5, follistatin-related protein 5, KIAA1263DKFZp566D234 | |
Rabbit | |
92 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FSTL5 | |
Synthetic peptides corresponding to FSTL5(follistatin-like 5) The peptide sequence was selected from the middle region of FSTL5. Peptide sequence NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD. | |
Affinity Purified | |
RUO | |
56884 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction