Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FSTL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | FSTL5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15285320
|
Novus Biologicals
NBP15285320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP152853
|
Novus Biologicals
NBP152853 |
100 μL |
Each for $487.50
|
|
|||||
Description
FSTL5 Polyclonal specifically detects FSTL5 in Human samples. It is validated for Western Blot.Specifications
| FSTL5 | |
| Polyclonal | |
| Rabbit | |
| follistatin-like 5, Follistatin-like protein 5, follistatin-related protein 5, KIAA1263DKFZp566D234 | |
| FSTL5 | |
| IgG | |
| 92 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 56884 | |
| Synthetic peptides corresponding to FSTL5(follistatin-like 5) The peptide sequence was selected from the middle region of FSTL5. Peptide sequence NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title