FUBI/MNSF beta/FAU Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232413

Catalog No. NBP232413

Description

FUBI/MNSF beta/FAU Polyclonal specifically detects FUBI/MNSF beta/FAU in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FUBI/MNSF beta/FAU
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 40S ribosomal protein S30, asr1, FAU1, FAU-encoded ubiquitin-like protein, FBR-MuSV-associated ubiquitously expressed, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed(fox derived), FLJ22986, Fub1, Fubi, MNSFbeta, monoclonal nonspecific suppressor factor beta, ribosomal protein S30, RPS30, ubiquitin-like protein fubi and ribosomal protein S30, ubiquitin-like-S30 fusion protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2197
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FAU
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only