Invitrogen™ Fumarase Monoclonal Antibody (9D8)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA533010

Catalog No. PIMA533010

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: K562 whole cell, human placenta tissue, COS-7 whole cell, HL-60 whole cell, Caco-2 whole cell, U20S whole cell, A549 whole cell, rat thymus tissue, rat testicular tissue, rat stomach tissue, mouse testicular tissue, mouse kidney tissue, NIH3T3 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, rat liver tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is an enzymatic component of the tricarboxylic acid cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.

Specifications

• Antigen: Fumarase
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P07954, P14408, P97807
• Gene Symbols: FH, Fh1
• Immunogen: A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat, Monkey
• Product Type: Antibody
• Isotype: IgG2a

• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 9D8
• Conjugate: Unconjugated
• Gene: FH
• Gene Alias: EF-3; Fh; Fh1; Fh-1; FMRD; fumarase; fumarate hydratase; fumarate hydratase 1; fumarate hydratase, mitochondrial; HLRCC; LRCC; MCL; MCUL1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14193, 14194, 2271, 24368
• Content And Storage: -20°C
• Form: Lyophilized