Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Fumarase Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579265
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579265 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579265 Supplier Invitrogen™ Supplier No. PA579265
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lymphaden tissue, rat small intestine tissue, rat gaster tissue, mouse kidney tissue, mouse testis tissue, mouse gaster tissue, human K562 whole cell, human U937 whole cell, human colon cancer tissue, human lung cancer tissue, human placenta tissue, mouse small intestine tissue, human mammary cancer tissue. ICC/IF: PC-3 cell. Flow: A431 cell, PC-3 cell.

The protein encoded by this gene is an enzymatic component of the tricarboxylic acid cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fumarase
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene FH
Gene Accession No. P07954, P14408, P97807
Gene Alias EF-3; Fh; Fh1; Fh-1; FMRD; fumarase; fumarate hydratase; fumarate hydratase 1; fumarate hydratase, mitochondrial; HLRCC; LRCC; MCL; MCUL1
Gene Symbols FH, Fh1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 14193, 14194, 2271, 24368
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.