FUNDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23174525UL

Catalog No. NB437214

Description

FUNDC2 Polyclonal specifically detects FUNDC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FUNDC2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9BWH2
• Gene Symbols: FUNDC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAASSQGNFEGDIESVDLAEFAKQQPWWRKLFGPESGLSAEKYSVATHLFIG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cervical cancer oncogene 3, Cervical cancer proto-oncogene 3 protein, DC44, FLJ33773, FUN14 domain containing 2, FUN14 domain-containing protein 2, HCBP6MGC131676, HCC3, HCC-3, Hepatitis C virus core-binding protein 6, MGC2495, PD03104
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 65991
• Target Species: Human
• Isotype: IgG

For Research Use Only