Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Furin Antibody, Novus Biologicals™
SDP

Catalog No. p-200006023 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB238446 100 μg
NB239211 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB238446 Supplier Novus Biologicals Supplier No. NBP321314100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Furin Polyclonal antibody specifically detects Furin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Furin
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Dibasic-processing enzyme, EC 3.4.21, EC 3.4.21.75, FURdibasic processing enzyme, furin (paired basic amino acid cleaving enzyme), furin, membrane associated receptor protein, PACEFES upstream region, paired basic amino acid cleaving enzyme (furin, membrane associated receptorprotein), Paired basic amino acid residue-cleaving enzyme, PCSK3furin, proprotein convertase subtilisin/kexin type 3, SPC1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Golgi Apparatus Markers, Stem Cell Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5045
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.