Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579287

Invitrogen™ FUT1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579287
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579287 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579287 Supplier Invitrogen™ Supplier No. PA579287
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Kidney Tissue, SW620 whole cell, A549 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human mammary cancer tissue.

FUT1 is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FUT1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene FUT1
Gene Accession No. O09160, P19526, Q10980
Gene Alias 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; alpha 1,2-fucosyltransferase A; alpha 12-fucosyltransferase; alpha(1,2) fucosyltransferase 1; alpha(1,2)FT 1; alpha12-fucosyltransferase a; beta-galactoside alpha-1,2-fucosyltransferase; blood group H alpha 2-fucosyltransferase; Fta; Fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (H blood group); FUT1; Futa; galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H; H transferase; HH; HSC
Gene Symbols FUT1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 14343, 2523, 81919
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.