Invitrogen™ FUT1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579287

Catalog No. PIPA579287

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Kidney Tissue, SW620 whole cell, A549 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human mammary cancer tissue.

FUT1 is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway.

Specifications

• Antigen: FUT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FUT1
• Gene Alias: 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; alpha 1,2-fucosyltransferase A; alpha 12-fucosyltransferase; alpha(1,2) fucosyltransferase 1; alpha(1,2)FT 1; alpha12-fucosyltransferase a; beta-galactoside alpha-1,2-fucosyltransferase; blood group H alpha 2-fucosyltransferase; Fta; Fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); fucosyltransferase 1 (H blood group); FUT1; Futa; galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H; H transferase; HH; HSC
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14343, 2523, 81919
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O09160, P19526, Q10980
• Gene Symbols: FUT1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG