Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FVT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31058825UL
Description
FVT1 Polyclonal specifically detects FVT1 in Human samples. It is validated for Western Blot.Specifications
| FVT1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| 3-ketodihydrosphingosine reductase, DHSR, EC 1.1.1.102,3-dehydrosphinganine reductase, FLJ36555, FLJ92680, follicular lymphoma variant translocation 1, Follicular variant translocation protein 1, FVT-1, FVT1KDS reductase, SDR35C1, short chain dehydrogenase/reductase family 35C, member 1 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of human FVT1 (NP_002026.1). Peptide sequence KKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCA | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2531 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction