FXR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP189546

Catalog No. NBP189546

Description

FXR1 Polyclonal specifically detects FXR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FXR1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Simple Western 1:100, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: fragile X mental retardation syndrome-related protein 1, fragile X mental retardation, autosomal homolog 1, FXR1P, hFXR1p
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of FXR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FXR1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Immune System Diseases, Immunology
• Gene ID (Entrez): 8087
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only