FXR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NBP189546	Novus Biologicals NBP189546	0.1 mL

Description

FXR1 Polyclonal specifically detects FXR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FXR1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Immune System Diseases, Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8087
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: fragile X mental retardation syndrome-related protein 1, fragile X mental retardation, autosomal homolog 1, FXR1P, hFXR1p
• Gene Symbols: FXR1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of FXR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only