Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FYTTD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FYTTD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FYTTD1 Polyclonal specifically detects FYTTD1 in Human samples. It is validated for Western Blot.Specifications
FYTTD1 | |
Polyclonal | |
Rabbit | |
forty-two-three domain containing 1, Forty-two-three domain-containing protein 1, Protein 40-2-3, UAP56-interacting factor, UIFDKFZp761B1514 | |
FYTTD1 | |
IgG | |
25 kDa |
Western Blot | |
Unconjugated | |
RUO | |
84248 | |
Synthetic peptides corresponding to the middle region of FYTTD1. Immunizing peptide sequence PSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title