Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ FZD10 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA569126
Description
This target displays homology in the following species: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%.
FZD10/Frizzled-10 is a 581 amino acid protein belonging to the G-protein coupled receptor Fz/Smo family and containing a signal peptide, a cysteine-rich domain in the N-terminal, seven transmembrane domains and a C-terminal PDZ domain-binding motif. It is involved in transduction, intercellular transmission of polarity information during tissue morphogenesis in differentiated tissues and as a receptor for Wnt proteins. FZD10 is expressed highly in placenta, fetal kidney, fetal lung, brain cerebellum, cerebral cortex, medulla and spinal cord with very low levels in total brain, frontal lobe, temporal lobe, putamen, adult brain, heart, lung and skeletal muscle.
Specifications
FZD10 | |
Polyclonal | |
Unconjugated | |
FZD10 | |
CD350; CD350 antigen; frizzled 10, seven transmembrane spanning receptor; frizzled class receptor 10; frizzled family receptor 10; frizzled homolog 10; frizzled homolog 10 (Drosophila); frizzled homolog 10, pseudogene 1; frizzled-10; Fz10; Fz-10; Fzd10; Fzd10-ps1; FzE7; hFz10 | |
Rabbit | |
Affinity chromatography | |
RUO | |
11211 | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
Western Blot, Immunocytochemistry | |
0.5 mg/mL | |
PBS with 2% sucrose and 0.09% sodium azide | |
Q9ULW2 | |
FZD10 | |
synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. | |
100 μL | |
Primary | |
Human | |
Antibody | |
IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction