Invitrogen™ FZD10 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA569126

Catalog No. PIPA569126

Description

This target displays homology in the following species: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%.

FZD10/Frizzled-10 is a 581 amino acid protein belonging to the G-protein coupled receptor Fz/Smo family and containing a signal peptide, a cysteine-rich domain in the N-terminal, seven transmembrane domains and a C-terminal PDZ domain-binding motif. It is involved in transduction, intercellular transmission of polarity information during tissue morphogenesis in differentiated tissues and as a receptor for Wnt proteins. FZD10 is expressed highly in placenta, fetal kidney, fetal lung, brain cerebellum, cerebral cortex, medulla and spinal cord with very low levels in total brain, frontal lobe, temporal lobe, putamen, adult brain, heart, lung and skeletal muscle.

Specifications

• Antigen: FZD10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: FZD10
• Gene Alias: CD350; CD350 antigen; frizzled 10, seven transmembrane spanning receptor; frizzled class receptor 10; frizzled family receptor 10; frizzled homolog 10; frizzled homolog 10 (Drosophila); frizzled homolog 10, pseudogene 1; frizzled-10; Fz10; Fz-10; Fzd10; Fzd10-ps1; FzE7; hFz10
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11211
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Form: Liquid

• Applications: Western Blot, Immunocytochemistry
• Concentration: 0.5 mg/mL
• Formulation: PBS with 2% sucrose and 0.09% sodium azide
• Gene Accession No.: Q9ULW2
• Gene Symbols: FZD10
• Immunogen: synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov