Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579289

Invitrogen™ FZD3 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579289
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579289 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579289 Supplier Invitrogen™ Supplier No. PA579289
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SK-OV-3 cell, human Jurkat cell. IHC: human colon cancer tissue, human mammary cancer tissue, mouse kidney tissue, rat kidney tissue.

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FZD3
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene FZD3
Gene Accession No. Q61086, Q9NPG1
Gene Alias AU020229; D930050A07Rik; frizzled 3; frizzled 3, seven transmembrane spanning receptor; frizzled class receptor 3; frizzled family receptor 3; frizzled homolog 3; frizzled homolog 3 (Drosophila); frizzled-3; Fz3; Fz-3; FZD3; hFz3; mFz3
Gene Symbols FZD3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 14365, 266715, 7976
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.