Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FZR1/CDH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156976
Description
FZR1/CDH1 Polyclonal specifically detects FZR1/CDH1 in Human samples. It is validated for Western Blot.Specifications
FZR1/CDH1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CDC20C, CDH1, Cdh1/Hct1 homolog, CDH1CDC20-like 1b, fizzy/cell division cycle 20 related 1 (Drosophila), Fzr, FZR2, FZRCDC20-like protein 1, hCDH1, HCDHFYR, KIAA1242fizzy-related protein homolog | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9UM11 | |
FZR1 | |
Synthetic peptides corresponding to FZR1/CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of FZR1/CDH1. Peptide sequence SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN. | |
100 μL | |
Cell Cycle and Replication | |
51343 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction