Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G gamma14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | G gamma14 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
G gamma14 Polyclonal specifically detects G gamma14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
G gamma14 | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
2793 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 | |
GNGT2 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title