Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GABA-A R pi Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | GABA-A R pi |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18239020
|
Novus Biologicals
NBP18239020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP182390
|
Novus Biologicals
NBP182390 |
100 μL |
Each for $487.50
|
|
|||||
Description
GABA-A R pi Polyclonal specifically detects GABA-A R pi in Mouse samples. It is validated for Western Blot.Specifications
| GABA-A R pi | |
| Polyclonal | |
| Rabbit | |
| NP_666129 | |
| 2568 | |
| Synthetic peptide towards GABA A receptor pi. Peptide sequence GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| GABA(A) receptor subunit pi, gamma-aminobutyric acid (GABA) A receptor, pi, gamma-aminobutyric acid receptor subunit pi, MGC126386, MGC126387 | |
| GABRP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title