Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    GABA-A R rho 1 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17997120UL
Description
GABA-A R rho 1 Polyclonal specifically detects GABA-A R rho 1 in Human samples. It is validated for Western Blot.Specifications
| GABA-A R rho 1 | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| NP_002033 | |
| GABRR1 | |
| Synthetic peptide directed towards the N terminal of human GABRR1. Peptide sequence MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG | 
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| GABA(C) receptor, gamma-aminobutyric acid (GABA) A receptor, rho-1, gamma-aminobutyric acid (GABA) receptor, rho 1, gamma-aminobutyric acid receptor subunit rho-1, rho 1) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 2569 | |
| Store at -20C. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction