GABA-A R theta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180078

Catalog No. NBP180078

Description

GABA-A R theta Polyclonal specifically detects GABA-A R theta in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GABA-A R theta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GABA(A) receptor subunit theta, GABA-A receptor theta subunit, gamma-aminobutyric acid (GABA) receptor, theta, gamma-aminobutyric acid receptor subunit theta, MGC129629, MGC129630, THETA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55879
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_061028
• Gene Symbols: GABRQ
• Immunogen: Synthetic peptide directed towards the N terminal of human GABRQ. Peptide sequence KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Equine: 93%; Pig: 93%; Bovine: 86%; Canine: 86%; Guinea pig: 80%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only