Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GABPA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP184941
Description
GABPA Polyclonal specifically detects GABPA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
GABPA | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
E4TF1-60, E4TF1ATranscription factor E4TF1-60, GA binding protein transcription factor, alpha subunit 60kDa, GA-binding protein alpha chain, GA-binding protein transcription factor, alpha subunit (60kD), GABP subunit alpha, human nuclear respiratory factor-2 subunit alpha, 10, NFT2, NRF2, NRF2A, nuclear respiratory factor 2 alpha subunit, Nuclear respiratory factor 2 subunit alpha | |
Rabbit | |
Affinity Purified | |
RUO | |
2551 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
GABPA | |
This antibody was developed against Recombinant Protein corresponding to amino acids:YDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction