Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GAD1/GAD67 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP321278100UL
Description
GAD1/GAD67 Polyclonal antibody specifically detects GAD1/GAD67 in Human samples. It is validated for ImmunofluorescenceSpecifications
GAD1/GAD67 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
67kD), EC 4.1.1, FLJ45882, GAD25, glutamate decarboxylase 1 (brain, 67kDa), Glutamate decarboxylase 67 kDa isoform | |
This antibody was developed against Recombinant Protein corresponding to amino acids: SSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER | |
100 μg | |
Diabetes Research | |
2571 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction