Invitrogen™ GAD65 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579293

Catalog No. PIPA579293

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. IHC: rat kidney tissue, human intetsinal cancer tissue, human mammary cancer tissue.

GAD65 (glutamic acid decarboxylase-65) are present in autoimmune disorders such as insulin-dependent (type1) diabetes mellitus (IDDM), stiff man syndrome and polyendocrine autoimmune disease. Auto-antibodies to GAD65 are present in 60-70% of individuals with newly diagnosed IDDM and thus are important markers for disease activity. These auto-antibodies usually recognize conformation-dependent regions on GAD65 and rarely bind to the second isoform, GAD67. Auto-antibodies to GAD67 are found in only 15% of recent-onset IDDM patients and most of this binding can be blocked with GAD65, suggesting shared epitopes between the two isoforms of GAD.

Specifications

• Antigen: GAD65
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: GAD2
• Gene Alias: 6330404F12Rik; 65 kDa glutamic acid decarboxylase; GAD(65); GAD2; Gad-2; GAD65; GAD-65; Glutamate decarboxylase 2; Glutamate decarboxylase 2 (islet); glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa); glutamate decarboxylase 65 kDa isoform; Glutamate decarboxylase-2 (pancreas); glutamic acid decarboxylase 2; glutamic acid decarboxylase 65; MGC161605; MGC161607; RP11-420F12.2
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14417, 24380, 2572
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P48320, Q05329, Q05683
• Gene Symbols: GAD2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG