GADD45 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179791

Catalog No. NBP179791

Description

GADD45 alpha Polyclonal specifically detects GADD45 alpha in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GADD45 alpha
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DDIT-1, DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, GADD45DNA-damage-inducible transcript 1, growth arrest and DNA-damage-inducible 45 alpha, growth arrest and DNA-damage-inducible, alpha
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer
• Gene ID (Entrez): 1647
• Target Species: Human, Pig, Bovine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001915
• Gene Symbols: GADD45A
• Immunogen: Synthetic peptide directed towards the C terminal of human GADD45AThe immunogen for this antibody is GADD45A. Peptide sequence LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.