Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GADD45 alpha Antibody, Novus Biologicals™

GADD45 alpha Antibody, Novus Biologicals™
SDP

Catalog No. NBP1797920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1797920 20 μL
NBP179791 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1797920 Supplier Novus Biologicals Supplier No. NBP17979120UL

Description

Rabbit Polyclonal Antibody

GADD45 alpha Polyclonal specifically detects GADD45 alpha in Human samples. It is validated for Western Blot.

Specifications

Antigen GADD45 alpha
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001915
Gene Alias DDIT-1, DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, GADD45DNA-damage-inducible transcript 1, growth arrest and DNA-damage-inducible 45 alpha, growth arrest and DNA-damage-inducible, alpha
Gene Symbols GADD45A
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human GADD45AThe immunogen for this antibody is GADD45A. Peptide sequence LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA.
Molecular Weight of Antigen 18 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 1647
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.