Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GADD45 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | GADD45 alpha |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1797920
|
Novus Biologicals
NBP17979120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179791
|
Novus Biologicals
NBP179791 |
100 μL |
Each for $487.50
|
|
|||||
Description
GADD45 alpha Polyclonal specifically detects GADD45 alpha in Human samples. It is validated for Western Blot.Specifications
| GADD45 alpha | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer | |
| DDIT-1, DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, GADD45DNA-damage-inducible transcript 1, growth arrest and DNA-damage-inducible 45 alpha, growth arrest and DNA-damage-inducible, alpha | |
| GADD45A | |
| IgG | |
| 18 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001915 | |
| 1647 | |
| Synthetic peptide directed towards the C terminal of human GADD45AThe immunogen for this antibody is GADD45A. Peptide sequence LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title