Learn More
Invitrogen™ GADD45G Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579295
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, rat heart tissue, rat testis tissue, rat skeletal muscle tissue, mouse brain tissue, mouse heart tissue, mouse testis tissue, mouse skeletal muscle tissue, human Hela whole cell, human placenta tissue, human SW620 whole cell, human A549 whole cell, mouse NIH3T3 whole cell.
GADD45G gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.
Specifications
GADD45G | |
Polyclonal | |
Unconjugated | |
GADD45G | |
AI327420; C86281; CR6; Cytokine-responsive protein CR6; DDIT2; DDIT-2; DNA damage-inducible transcript 2 protein; GADD45G; GADD45gamma; GADD45-gamma; gadd-related protein, 17 kD; growth arrest and DNA damage inducible; growth arrest and DNA damage inducible gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; growth arrest and DNA-damage-inducible 45 gamma; growth arrest and DNA-damage-inducible protein GADD45 gamma; growth arrest and DNA-damage-inducible, gamma; GRP17; OIG37; RP11-260L6.1 | |
Rabbit | |
Antigen Affinity Chromatography | |
RUO | |
10912, 23882, 291005 | |
-20°C | |
Lyophilized |
Western Blot | |
500 μg/mL | |
PBS with 4mg trehalose and 0.05mg sodium azide | |
O95257, Q9WTQ7, Q9Z111 | |
GADD45G | |
A synthetic peptide corresponding to a sequence of human GADD45G (MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.