Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GADL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP17961220UL

View more versions of this product

Catalog No. NBP1796220

Description

GADL1 Polyclonal specifically detects GADL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GADL1
Classification	Polyclonal
Dilution	Western Blot 0.2-1 ug/ml
Gene Accession No.	NP_997242
Gene Symbols	GADL1
Immunogen	Synthetic peptide directed towards the middle region of human GADL1The immunogen for this antibody is GADL1. Peptide sequence SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	glutamate decarboxylase-like 1, MGC138191
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	339896
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

GADL1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions