Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GAGE7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP30960325UL
Description
GAGE7 Polyclonal specifically detects GAGE7 in Human samples. It is validated for Western Blot.Specifications
GAGE7 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AL4, Cancer/testis antigen 4.7, CT4.7GAGE12I, G antigen 7, GAGE-12I, GAGE7B, GAGE-7B, GAGE-7cancer/testis antigen family 4, member 7, GAGE-8 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAGE7 (NP_001468). Peptide sequence AGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQS | |
25 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
2579 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction