Invitrogen™ Galectin 4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595353

Catalog No. PIPA595353

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: SW620 whole cell, COLO320 whole cell. ICC/IF: A431 cell. Flow: THP-1 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. Galectin 4 binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.

Specifications

• Antigen: Galectin 4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Lgals4
• Gene Alias: Antigen NY-CO-27; GAL4; gal-4; galectin 4; galectin-4; L-36; L-36 lactose-binding protein; L36LBI; L36LBP; lactose-binding lectin 4; Lectin galactose binding soluble 4 (Galectin-4); lectin, galactose binding, soluble 4; Lectin, galactose binding, soluble 4 (Galectin-4); lectin, galactoside binding soluble 4; lectin, galactoside-binding, soluble, 4; lectin, galactoside-binding, soluble, 4 (galectin 4); Lgals4
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 3960
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P56470
• Gene Symbols: Lgals4
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov