Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GALNT11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169008
Description
GALNT11 Polyclonal specifically detects GALNT11 in Rat samples. It is validated for Western Blot.Specifications
GALNT11 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 2.4.1.41, FLJ21634, GALNAC-T11, MGC71630, Polypeptide GalNAc transferase 11, polypeptide N-acetylgalactosaminyltransferase 11, pp-GaNTase 11, Protein-UDP acetylgalactosaminyltransferase 11, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 11 (GalNAc-T11) | |
Rabbit | |
69 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q921L8 | |
GALNT11 | |
Synthetic peptides corresponding to Galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11)) The peptide sequence was selected from the N terminal of Galnt11. Peptide sequence LGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYP The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
63917 | |
Rat, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction